dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSPVAP00000005532 (Pteropus vampyrus 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:pteVam1:GeneScaffold_2711:143657:164701:1 gene:ENSPVAG00000005847 transcript:ENSPVAT00000005848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 631
Sequence
MISFRQAAYFICLFATVSCECRTRLYKNTFFRGGDVTAMYTPNAQHCQKMCTFHPRCLLF
SFLPVGSTNDTDKRFGCFLKDSTTGILPRVSRTSAISGHSLKQCGHRISACQRDIYEAID
MRGVNFNVSRVKSVEECQKRCTNSIHCKFFTYAMQTFHNSEYRNSCILKHSPTGTPTSIK
VLENVASGFSLKPCALSEIGCHMNMFQHLKFSDVDVARVTAPDAFVCRVICTYHPNCLFF
TFYTNDWTVESQRNVCLLKTSKSGTPSSPTPQENALSGYSLLTCKRTLPEPCHSKIYTGV
DFGGEELNAIFVKGVSDCQETCTKMIRCQFFTYSLLPEDCRGEKCKCSLRLSMDGSPTRI
TYETQASSGYSLRLCKVGDDSDCTTKISARIVGGTNSSWGEWPWQVSLQVKLTAQSHVCG
GSIIKKQWVLTAAHCFDGLLFSDIWRIYGGILNLSEITKETPFSQIKEIIIHPNYNISES
THDIALIKLEAPLNYTEFQKPICLPSKDDTNTIYSNCWITGWGFTKEKGEIQNILQKANI
PLVTNEECQKRYRNYEITKQMICAGYKEGGKDACKGDSCGPLVCKHNGIWHLVGXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGGE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]