dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

VDBG_07826T0 (Verticillium albo-atrum VaMs.102 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | VDBG_07826 | Verticillium albo-atrum VaMs.102 ran-specific GTPase-activating protein (258 aa)
Sequence length 257
Sequence
MSAPEATEPKVEEPKIEAPKAEEAPATGTADAPATESTGEADKPVTAQSSVFSMFGGGAK
KEKKPEDEDRGDNSGSNKAQREAAAAAADDDQAPESEDVHFEPVHKLTEKVETATNEESE
QQLFKMRAKLFKFIKESSEWKERGTGDVRLLKHKENGKTRLVMRRDKTLKVCANHYIVPE
MKLSPNVGSDRSWVWNAAADVSEGEPEAATLAIRFANSENANLFKDAFLQAQKDNEALFK
KAEDGEASTETPAAEQS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]