dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Volca1|55676|e_gw1.1.522.1 (Volvox carteri f. nagariensis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 402
Sequence
PGSRLNVAVLLSGGVDSSLALRLLRAAGHTCHAFYLQIWFQEDFRNFWGACPWEEDLQYA
RQVCESLGVPLEVVPLTTEYWDRVVSGSVEEIRAGRTPNPDMWCNSRVKFGAFYDYLDRT
YGAAFDRVASGHYARVERVPRRSSPAEVRLLLTPDAVKDQTYFLANLSPRQLSRVMFPLG
CLTKSQVRKLAAAADLANKNRKDSQGICFLGKVKFHEFVREHLGEWPGPILEAETGQPLG
LHQGYWFYTVGQRGGIKLPGGPWYVVAKDTLRNAVLVSRQYYDADKQRNTFTCGPFNWLD
AATRPDPDPRAGPLFVKVRHGPSMYCCELRLHDARGDGSYGNDSYGTVVLAQNDQGLAAG
QYAVFYQDGRCLGCAVIQETVDVGGAGRREKTGAPAAVSSKA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]