dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSPVAP00000013088 (Pteropus vampyrus 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2934:71806:78853:-1 gene:ENSPVAG00000013879 transcript:ENSPVAT00000013880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 609
Sequence
MRALLLLGSLLVSLESALLTPPRKAPMVHKHVGDKHTVVLTVTGEPCHFPFQYHRQLYHK
CTPKGQHGPRPWCATTPNFEQDQRWAYCLEPKKAQDHCSKHNPCQRGGTCVNMPRGPHCI
CPEHLTGKHCQREKCFEPQLFQFFHENETWLKLKPAGVAKCQCQGPQAHCKPLASQVCPT
NPCLNQGRCLEVDGHQLCSCPEGYAGRNCDVDIKASCYHGRGLSYRGTADTSFSGARCQP
WASEVTYRNLTAEQARSWGLGHHAFCRNPDNDTRPWCFVWSGDRLSWEYCLLSPCQAPTR
AAPQTPGAPRLPLPSLSALQKPQTTTQTPPQSPMLASRAMPEQRTPLPTKGPAGCGQRLR
KRLSSMSRISEGLVALPGAHPYIAALYWGHNFCAGSLIAPCWVLTAAHCLQNRPAPEELT
VVLGQDRHNQSCAQCQTLAVRTYHLHEAFSSITYQHDLALLRLQESADGNCVRLSPSVQP
VCLPSSAARPGESEAMVCEVAGWGHQFEGAEEYSTFLQEAQVPLISQERCSAPDVHGTAF
APGMLCAGFLEGGADACQXXXXXPLVCEDAAEHQLIRGIVSWGSGCDRNKPGVYTDVAYY
LTWMQEHTN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]