dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSVPAP00000000438 (Vicugna pacos 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_990:234617:491579:1 gene:ENSVPAG00000000466 transcript:ENSVPAT00000000468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 1472
Sequence
VFDNCSHTVSDKGWALGIRSGKDVGRRDARFFFSLRTDRVTKATIVMGHSRYQPGKWTHV
AATYNGQRMVLYVDGTQVASSPDQSGPLHSPFMASCRSLLLGGDSSEDGHHFRGHLGTLV
LWSTALPQSHLQHSPQQPSEVEHLSTLILTASFEPLEEQWAPFRDEKYPRLEVLQDFEPE
PEILSPLQPPLCGQTACDNVELISQYNGHWPLRGEKVIRYQVVNICDDEGLNPTVSEEQI
HRQHEVLNEAFSRYNISWQLSVHQVHNSTLRHRVVLVNCEPSKIGNDHCDPECEHPLTGY
DGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPEVADVHKTCFDPDSPRRAYM
SVKELKEALQLNSTHFLNVYFASSVREDLAGAATWPWDKEAISHLXXXXXXXXXXXXXXH
GNIMMREVGQVMGIYHVFKGVSERESCDDPCRKTVPSMDTGDLCADTAPTPKSKLCQDPE
PTNDTCGFTHFPGAPFSNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSQSRKPTPIP
LPPMVIGQTRKSLTVHWLPPISGVVYDRVPGSVCGACTEDGTFRQYVHTASSRRVCDSSG
YWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPAEGCSLELLFQHPVQADTLT
LWVTYLSMDSSQALFDTEILLEHQESVHLGPLETFCDTPLTIKLHVDGKVLGAKVYTFDE
RMEIDAALLTSRPHSPLCSGCRPVRYQVLREPPFASGSSVVVTHLHRKFTDXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLGECDDGDLLSGDCACLEFCVGEP
SLCYIYEGDGICEPFEKETSIIDCGLYTPKGYLDQWAIQAYSSHEDKKKCPVSLVTGEPH
SMICTSHHPGLPEHRPLTGWFPCVTSQNRPQDEGRKQPKGSLEREDEVWLKVCFNRPGVA
TAIFIFLTSDGLVPGGHQRSTVTLHLTDVSGNSHSLGTYELSCQHNPLVINVTHPSHVLS
HRTASVLLNFSSPLVGISAVALRTSSHISPPAPNSCTPEHQGQNRQGQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKELLTCPGYWDRAV
SCMPLDCGPDPSLVNYATFCSEGTNFLKRCSISCVPPAKLQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPILCTKKGLW
TEEFKLCENLQGECPPPTSELNFVEYKCEQGYGIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSIVCTGRRQWHPDPLLIHCIQSCEPFQADGWCDTINNRAYCHYDGGDCC
SSTLSSKKVIPFAADCDLDECTCRDPKAEENQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]