dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSVPAP00000001577 (Vicugna pacos 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1735:325889:330096:1 gene:ENSVPAG00000001707 transcript:ENSVPAT00000001707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 290
Sequence
KLYVELHHNSPVLLCTDFKRAQKETVDPTYLWIGPNEKPLTGTSRINITKTGKLLVKDFL
EPLSGLYTCTLSYKIVKAETQEEKTVKQRYDFMLFXXREPDYAYQAVRTTNLCEKYNDLF
KVLKKILNNLISDLSCHIIEPSYKCHFVKIPKHGLTHELFIAFQVNPFAPRWKGTCNESV
DCEDTTNHNILQARNRIEEFFRRQAYIFKHDFKKTLPAMHFVDHSFHIMRMDSCRPGFGK
NEGLHSNCASCCVVCSPGTFSPDVDVTCQTCVSTRIYGAKTCPTKNQCED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]