dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSVPAP00000005455 (Vicugna pacos 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1882:144759:181714:1 gene:ENSVPAG00000005873 transcript:ENSVPAT00000005873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 980
Sequence
VDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNI
PGNYRCTCYDGFHLAHDGHNCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGCQ
HTCDDTEQGPRCGCHVKFVLHTDGKTCIXXXXXXXXXXXXXXXXXTCAVNNGGCDSKCHD
AATGVHCSCPVGFMLQPDRKTCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXIDECSFDRTCDHICVNTPGSFQCLCHHGYLLYGVTHCGDVDECSINRGGCRFGCI
NTPGSYQCTCPASQGRLHWNGKDCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCTRCPGNTSTDFDGS
TSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPS
EDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPY
VTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEML
PKSFIKLLRSKVSSFLRPYK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]