dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSVPAP00000008304 (Vicugna pacos 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2280:458195:957540:-1 gene:ENSVPAG00000008925 transcript:ENSVPAT00000008926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 3401
Sequence
HHGELEGDGEQGEVLISLHIAGHPTLVSGQESHVTISTSTFFDGLLVTGLYTSTSVQASQ
SIGGSSAFGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATAT
HRGQIIFKDALAQQLCEQGAPTEATVHPHLAELHSDSIILRDDFDSYHQQELNPNIWVEC
NNCETGEQCGAIMHGNAVTFCEPYGPRELITTALNTTTASVLQFSIGSGSCRFSYSDPCI
IVSYAKNNTADWIQLEKIRAPSNVSTIIHILYLPEAAKAENVQFQWKQENLREGDVYEAC
WALDNILVINSAHRQVVLEDSLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFN
FATTRDVDLSTEDIQEQWSEEFESQPTGWDILGAVIGTECGTIESGLSMVFLKDGERKIC
TPYMDTTGYGNLRFYFVMGGMCDPGDSHENDIILYAKTEGRKEHVALDTLSYSSYKVPSL
VSVVINPDLQTPATKFCLRQKNHQGHNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGT
HQPGNSVSLEFSTNHGRSWSLLHTECLPEICAGPHLPHSTIYSSENYSGWNRITIPLPNA
ALTRDTRIRWRQAGPILGNMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGLSGPACEM
ASQTFPMFISESFGSSRLSSYHNFYSIRGEEVSVSCGVLASGKALVFNKDGRRQLITSFL
DSSQSRFLQFTLRLGSKSVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYLNYHEPR
IISVELPDDARQFGIQFRWWQPYHSSQGEDVWAIDEIIMTSVLFNSISLDFTNLVEVTQS
LGFYLGNVQPYCGHDWTLCFTGDSKLASMRYVETQSMWEFSYMIQFSLVMGCGQKYTPHM
DNQVKLEYSTNHGLTWHLVQEECLPSMPSCQEFTAASIYHASEFTQWRRVIVLLPQKTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCDQGYQGTDCRPEAA
LPSTIMSDFESPNSWESDWQEVIGGEIVKPEEGCGVISSGSSLYFSKAGKRQLVSWDLDT
SWVDFVQFYIQIGGESAACNKPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFSRPRFVYL
ELPAAAKTPCTRFRWWQPVFSGEDYDQWAVDDIIILSEKQKQIIPVVNPTLPQNFYEKPA
FDYPMNQMSVWLMLANEGMVKNETFCSATPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFH
LNIGCANQFSSAAPVLLQYSHDAGMSWFLVKEGCYPASVGKGCEGNSRELSEPTMYHTGD
FEEWTRITIVIPRSLASSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCVS
GVCFCDLGYTAAQGTCVSIVPNPSEMFDRFEGKLSPLWYKITGGQVGTGCGILNDGKSLY
FSGSGKREARTVPLDTRNIRLVQFYIQIGSKTSGITCIKPRARNEGLVVQYSNDNGILWH
LLRELDFMSFLEPQIISIDLPREAKTPATAFRWWQPQHGKHSAQWALDDVLIGVNDSSQT
GFQDKFDGSLDLQANWYRIQGGQVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASTFL
QFEMSMGCSKPFSASHGVQLQYSLNNGRDWHLVTEECVPPTIGCLHYTESSIYTSERFQN
WKRITVYLPFSTISPRTRFRWIQANYTVGADSWAIDNVVLASGCPWMCSGRGVCDAGRCV
CDRGFGGTYCVPFLPLPSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTSLIFKGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTPERSHSILLQFSINGGITWHLMDEFYFPQTT
NILFINVPLPYTAQTNATRFRLWQPYNNGKKEEIWIVDDFIIDGNNLNNPVMLLDTFDFG
PREDNWFFYPGGNIGLYCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLNVNENTIIQFE
INVGCSTDSSSADPVRLEFSRDFGATWHLLLPLCYHSSSHVSSLCSTEHHPSSTYYAGTT
QGWRREVVHFGKLHLCGSVRFRWYQGFYPAGSQPVTWAVDNVYIGPQCEEMCNGHGSCIN
GTKCICDPGYSGPTCKISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLF
FNEDGLRMLMTRDLDLSHARFVQFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFL
FSNSSNVGRYIALEIPLKARSASARLRWWQPSENGHFYSPWVIDQILIGGNIYGNTVLED
DFTTLDSRKWMLHPGGTKMPMCGSTGDALVFIEKASTRYVVTTDIAVNEDSFLQIDFAAS
CSVTDSCYAIELEYSIDLGLSWHPLVRDCLPTNVECSRYHLQRVLVSDTFNKWTRITLPL
PPYTRSQATRFRWHQPAPFDKQQTWAIDNVHIGDGCVDMCSGHGRCIQGDCVCDEQWGGL
YCDEPETSLPTQLKDNFNRAPSNQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRLLVTV
DLNLTNAEFIQFYFMYGCLITPNNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNI
LLPPDAKEMATRFRWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPPHERS
PADAGPVGRIAFDMFMEDKTAVNEHWLFHDDCTVERFCDSPDGVMICGSHDGREVYAVTH
DLTPTEGWIMQFKISVGCKVSEKVAQNQIHVQYSTDFGVSWNYLVPQCLPADPXXXXXXX
XXXXXXXXXXXXXXXXXXXXSLVGNSVRFRFYQKHSDMQWAIDNFYLGPECLDNCRGHGD
CLKEQCICDPGYSGPNCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILAEDT
ALYFGGSTVRQAITQDLDLRGAKFLQYWGRIGSENNMTSCHRPICRKEGVLLDYSTDGGI
TWILIHEMDYQKYISVRHDYILLPEDALSNTTRLRWWQPFVICNGLVVSGGAXXXXXXXX
XXXXXXGTSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYM
MQFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXATQFRWIQKGEEAEKQSWAIDHVYIGEACPKLCSGHG
YCTTGAVCICDESFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIMFVLQIGSASQTDSCNSDLSGPHAVDKAV
LLQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXSSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]