dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

AGAP004959-PB|IMD (Anopheles gambiae VectorBase AgamP3.6)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pathway signalling, Immune Deficiency (Imd).|protein_coding|2L:7194668-7195587:1|gene:AGAP004959
Sequence length 279
Sequence
MVKFSNLIGTLFSKSAASKLETDAAPLPPRRKADAYGDETMAHTNTPAAAAATQNGNFPN
GVQVVPGMENLALVPGGSSQSLEPVAGEHHTATPQTVVNNVQHNTLTAPQTSISNTTGMQ
VFQIRNASNLHIGNSYTFNTAAVVDEGASTSGSLPGAGSAVKWANLRLSNTISQMMQSQD
EVDTELLDTVSRHLGYEWKSFARRLEYSEGQIDAFEADNSTLAEQIYSFMLDWTRNDDDP
TLGRLVTLLWNNKHKETVYYIKQVWKKRKEDKNSPERSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]