dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

AGAP007173-PA|IMD (Anopheles gambiae VectorBase AgamP3.6)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pathway signalling, Fas-Associated Death Domain (FADD).|protein_coding|2L:43821855-43822693:-1|gene:AGAP007173
Sequence length 255
Sequence
MERISVQDHRAVYERLCKDYLNLKLLAQNACHGPERLERCKQSVRQDIHSCRKLSRITQF
EQLVALMEQRNLVSLLKPDLIERFVLALDTKEVGGALTSYRNVLRSHYEPVRRFYLEDLR
HRDRRTLLEKEVERIKLQESTEPPAVTPRPPTATTNAKRDAYLRQREGIYSLLQLEIGKS
WKVFGRFLNVPAGELDEIEERNRQDLKTRIYETLEWAEMQYDDAALDQYVGVLLKALESS
RRKDLKRKIETMLQR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]