dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

AGAP009061-PA|hypothetical (Anopheles gambiae VectorBase AgamP3.6)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein|protein_coding|3R:24971053-25005712:-1|gene:AGAP009061
Sequence length 912
Sequence
IESFGAGNDGTPLPVFLVEPKGAYVMKNRPAKLYCKASHALQISFKCSGSTKPPPTEKEH
HTDPHSGVQLQEATATITRELVDEFFGKGPFKCECRAYSSRGHVKTQPVTIQVATIKKQI
SISPKIVRVATGGRAELNCIANATPAAKVVWLKNSVPVHANPPFVLLTENALLIARVEIQ
DMANYTCVAENIAGKRVSDPVPITVYVDGGWSSWGPWTDCKCPGHGKQGQKRTRVCNSPV
PMNNGAPCKGASTESTPDCLPCSAGRWSSWSEWSECGPDCTQIRQRSCVAFAIDSGTIVN
CAGKSQQSIKCTGGLCNYTAQDSNWSVYLWVTLVAAFCLGVVFAVSKFLRRKKTIPAYNL
APAAASSSSVFAAPPARQQPARAGSHRTRTASSPVPIAASANPSDRGPQIVIAFATVQFR
APLRRAPFCNLWAPSIAVPKRSGRLPHGGAYLTDWSPKLTHHPGQTRAAKTAKKGDRAQN
GSRSRAPALFADHQTDPPERPSSVTHATLTPAGALLRLATYSTALLIPEGAIPKHQRHSV
ALSIVRDDKHHVPVPTGPRSTYLSPVVFCGPVDTKVNKPIVMQLPHCAENLSDWAFSLYS
APDNVTPWCKVVTIGEETLNTPALVQIDKRYAYVLTETFGKYVLVGESATDIQERVACKR
LRLFICGPSTVPEFSDVSLRVYIVEDNPGAEERCRHCEQEIGGVLLGRSTVLHFADVGQA
GLNIDLQCVGGWRAKSSSERQTIPFSHVWNSACTALHCSFTLCRTEHDKCDFKIVVQASQ
DVPQGLDERLTAIGVPATLSISSVGSGDHNTNLVATDRFRLSKDVKRKLCRCLDPPTQKR
NDWRMLAAHLNVDRYLTYFATRPSPTDQILDLWECRNRDLNALQQLIEICRTMERPDAVA
ILEQIQPAAPWV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]