dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

AGAP010715-PA|hypothetical (Anopheles gambiae VectorBase AgamP3.6)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein|protein_coding|3L:8923263-8931171:-1|gene:AGAP010715
Sequence length 1350
Sequence
FGDFFQNILERAEKRAAALGITNTSKFPLSEFNYEADQQGSAAGASPKKKSGGAAGASPK
KKSVTKKHSAPKPPPPTTTVSTRTATDGERTTTVDIGGQDNCDLALEINITTSANLQVDL
GVKELENDGSVKKQWEHNIVRALEGEKENSAEAKSVIRDQSRNQLQRLGTLYSETQDLSS
PVHRTEGRFHEDVKQSSNKPKPKLAKLAMLADSINNWEDDTSHPDITHHRETIVPGRERK
SPISSSSTRQQSPKRAGEARTGASGSSAPGTGATPKKYPAPNPPKSILTATQKTGSNGGG
EPSSGAAGKPVQTKSLKWDQKVMDTLESQGFQRRESTTSKLVYDYKEDKNGQKTDTYRAP
VTASAVSSTSRERNTTQADQADAVKKSAPVSSSSSQPKKVAVGAPKPAGGLVSGRAAMFE
KSSGRRQSILKPGQKDPAEMSLKERMAIFEKNKGAALVPKAAFGISPSIRQITGQKEGGK
SGSSGSGPMSCAAIQGSGFGSITQQAASSKGVAPASPQSKPKVDHDKAAPKVETKATGSA
IRNTVEALMSDTSTISQSEISEEIRRMRQQEMEMLLNRFTKPADMSSDTIEYETQPIPSA
PPMPPEGYLTGSGRKQSKHSAEGNNVHDGTNDSADVMAALDDVKRIRVGPAAKDGRMYPA
LSDIETTATESGDEGAVGDDYTTATVSGSEGSERAYRTCYGEAEDGERELGDEEEDYDEE
EDNERRHFMYSDDDEEANIANVSLGREILQAVKLNDRRTSRGRRQSQEWNGVSFSLDRSG
ASDGTDPLEDSDLIDACLEEALVDEEEEEEDSEAFDTPRKSSVSSNSFSYQKHSGRDRCA
TINEEESAKDPKSGANKRKSGTPRKSQVGTVDYSSPVRSELQVKPSKDDDDMVTLVHTVS
FYRRQQQQNSMTPRKVPRTPVSTKMAATNSSPRAGTSTSTGTEEGEFLVQEKVKKLLDEV
CKQQTIIAQASQALNLCAATIEFSGSTESAEGERHLLVATHRRQAILDEVQRLRVEGCLR
PPGAPTEKGRLTVKEITLPLKQEYMRKLATDQISGHNLVCLLKYNETVLATQTAPTLPGL
LSVRFPDVLQLSNVFADFKITMEIYGMPASREVLPHEIKYHIALGKKKTGSGSSKLLHTP
KGLKSNSRLIMPPVQSPAGPQAVRSPSLTQYGFIIFSLKEIQRTSWTLNPISGCASPLDG
TVNMRVNCELAVTVDYHGFLTMYEDVSGLGAWHRRWCRLQRHTINYWKYPDDEKRKAPIG
SIDLQGCSTQRVGVAPRDICSRLNTLLLEFPRPARDDDVESLKIVRHGKTTIERYLLSAD
SKEERDEWCAHLNKTLALLKAWGASHVTSC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]