dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|384460819|ref|YP_005673414.1| (Clostridium botulinum F str. 230613)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment N-acetylmuramoyl-L-alanine amidase [Clostridium botulinum F str. 230613]
Sequence length 579
Sequence
MNDNAKDQLKKLDTKEVIIVGGPGSISEDIATELKNLGIKVNRIYGEDRYKTSLKIAKEI
GVKNGVVVTNGLGFADALAMAPIAASKQMPILLTPSDKLTSDTMEFLTKSSYNKSYVLGG
TATVSDYIKNSLKNPTRLSGDDRYKTNIAILSHFKQDLNLNEVYITSGDGYADALSGSVL
ASKNKSPIILINDNLNKSTKDFVSTNKFDFKNVTIFGGEGVVKEPTISSLFGAFRSGETR
SDTKEVVAERWDRSYLKDYHIDLPKEGKLDIEYDFNDFTRFDLIVLDKKGNEIIKKSYNY
LNKNKSIHDNYNDIRLPKGSYIVRVHAFNMNGTYTIKAKYTQEGEGFEKEFNNDIKTANL
IEPNKSIIGSIHSYNDVDYYKFTLNEKGSLKINLKHNQYGRYGFRVSLLDENNKSITEFI
SGGEDINSYSNKLRLAKGTYFVKIECEKWNDEPLQYELNLVYNIEGENYESEPNDYIQDA
NYIKCNKEYIGNIQSRDDRDYYKINLNSDSKITINFKHDEGYGKWTILLCDKDNNPIRRF
KSYGYEINKDFGPIELKEGEYYVSIEGKDDLDYTINILK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]