dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CBN03790 (Caenorhabditis brenneri )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment CN27306 WBGene00142515 status:Confirmed
Sequence length 109
Sequence
MSLTADPPACTVPAAGGTSTHKLINAGAEKMIFKIKSSNNNEYRISPVFGFVDPSGSKDI
QITRTAGGPKEDKLVIHFAVAPADATDAQAAFASVTPAGTVTIPMSATA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]