dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|374295463|ref|YP_005045654.1| (Clostridium clariflavum DSM 19732)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Cellulose binding domain-containing protein [Clostridium clariflavum DSM 19732]
Sequence length 655
Sequence
MNKVKNDGLESFGVILKVKKNSVIVMTDKLDFVELNRKPDMLRGQKIYFTSLDLCNSSLW
LLNSKKFLKFASAAASVAAVFAILFFGFRFLFLSNEYAYIDLDINPSIEITINRNENVLK
AEALNNDGQILLDAVKIKNMDLKDAVSLLLNKSREIGFIDSFNNKVILAAALNSSKVSES
QNKNINSMISSLKQIAEKSGVESQVIQLSYKDRKEAMENGLSMGKYYIYTKAKDEGIQIT
VEEVKNSNISTLLSKIDLSENTNDPQNPSADIEPTPEPIVQPSSSQMVASIPSVAAPTAT
DKTSHTFKPVATPEPSFISEHTPSPAATMVTEVVEPSITPDRAIITPHRTYYITSTPKPV
FSTTPTPSPRPTVNVTVTYRPSPVVTPTKTPTPRVIITNSPTFKPISTKFSTPTTKKTPT
PSVYTATPKITVIPSSKPSTPTSNPTPIISSKPTPISTLTFTPTPKITSTPIITTAPTPI
ITPSPTPKPTTAPTSTPIEQTSVKLGMYNEVRTDKAKEIHPRFKLINTGNTPIKLSTVKI
RYYYTIDIEDKQQVFYCDWSNIGRNSITGKLVKMNTGRNDADHYLEIGFDTDESLEPGSN
IEIICRIGPDNTIGDGNIFYNQLNDYSFNNSAGNFVNWDKVTVYISGNLVWGTEP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]