dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CAOG_06137T0 (Capsaspora owczarzaki ATCC 30864 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | CAOG_06137 | Capsaspora owczarzaki ATCC 30864 hypothetical protein (2287 aa)
Sequence length 2286
Sequence
MNKTPRATLLLLLVLALISASAHGVSIVTGPSDKVVCAEQNVHLNLLVGETGGETNCCTA
TVERAIKNDDEWVAIPTVSATTTAVDASSSNVAIELAPSQVNDEFTYRITIETLDGATVT
SQEFFLAFSLPAVLQAPETNVAAQSAISVTAQLTPLRQEPELSVIRFTNSGPGFLQFRQS
SSSVSDFEYEVVDNVNADTMFEILPTLTLDTSTILLVDQADADHFLAWLDAFFAQSLQYL
SDPIGASSVAIALRDFNGLSFTSTSTWLGIYTAAQAQIHDAGAIADFEAEFGGRTFTLLF
SAPTKVDVVVRNSQGSYLGWMTSPQSLTALTQIDATQCAHKWFLDNSRLKASCSSTRALS
HLLTAPLLGTAILPTSQIAIISQYTTSSRTTSAITDSTYSIGSGATSSAVGVWSSRRCQQ
VGTSHLQSLLECAAQDDNPTYRQVHIELGAFGFGIKYVTVDLTHYPLPYPVDGPSAAILP
RQSGHSTSTKSRLELWVALAPSGTWIDVTDSVTEDFTRDCVSRGQRQRPCRVTFDVLEYL
RASDTILGNQAISDLRLVFDGIEPSSLDLDAAYRYFGISEVQAIGTCICNGHSSTCNYAT
GQCTGCEHHTQDDTCGSCDNTHWENRRNSLPAEVVNCDLAAPAVDNVLVCDGPALADIDV
SELESLFFESGGRSGVIVPGVSARDLPSAIFSKFFATGGACVLCNCHNHSLADAGQNVRG
CDASTGVCNCDPTTETTGDHCESCQATWCRSTSPCNNTPLSSSDLYACRLQSCSNERCDC
NGHSTLPQVGGFDQCDGNGCGCSCNPADGVTGPHCESCLPGHFSSTGDGVDGETCEPCFC
NGHKGSPETCDVSGGNCDQAGDPCQDNTTGFNCELCLDGFYRPFRPDGSIDPTDDCIPCA
CNGHGVGPALCNPNGGVCDCDPASNSEGDQCQSCIVGFWSATGNAESGTSCSACECNGHK
DYVSNECNALGGDCMTDFSGAPQPCDGNTNDFHCQGCVATFFRPCTVGVPTACSAVDYTD
DCSPCDCNGHSVSPIGGLDTCNAEGGLCTCTSSSNSEGDSCENCKPNTWNDFGNSEDGRD
CAPCACYGHSATCSNFGVCSGCQGNTEGNNCEQCVASNSRVNPAAFVGWDLPTPDPAVIT
TMREQDCTPCNCNGHSLNNPTIAPGICTPELGICLNCGGNTANGAANECDTCVPGFFRQL
TSAGFDPASDTCNACSLVDGDCTSDALTDACRPCSEQCFGANTMCGADTGICQECALSHA
ESHRCASCQNGYFGNPAGGIPCTPCKCYHSAPSKFDLLTETEIGTFQQCLFDNSLGGVSG
GAQTCIFDHSVNPDDAAADPQSAILCSCPRSIPGGFFNIISSGVVYEGRTCDSCNQDAYF
GQPTQCLTPGVGGSGLGDCLSFDTCNECICNGNIDESSMMDNCDYSAGNPSNLICEACLG
HSTGPNCEVCEVGYYGDPTRLDTPGTIGTGFILDASGESLKCFQCDCNGHSIARVVPGTE
GDVHNDTCTTVAPGFVGNYTCDCDSANGYTGPTCRECLLGYEQIALGGNLFRCDPCDNCT
RDAAAIIYGLIADYQHTMSLSQSVAASTAAIAAEITAIKDSLGLARRDADAVAGKAATII
AFLPTVQPLASDDKARSQQLNDLLEAFDDQTAQQATELTAQLAGLLEDASQVGNMLESPV
VDRLHDATSTLANLLARNTANRDQLVTLETSLESTMTAFASSSNWLSTHLQFAVDGREEL
DAAAEGLKYDRAEMEDSVAKPLNKLTLVWESVAAALEAQSSADLMALVERAGTDALRRLD
ALAARVSKLGSLTNQDKVLLSTNRDTLAELSARATLLEADLANKELEQSHAIIVIALGGI
DQAVRQFAEQAGLAEDHLMASLRDLDPAKAPHVTELVERISTDLEQHRTELVDSSAAMIQ
ELRAASAAAFATAQTNLATVQSQNARLMVLQSMLELIDKAAHKALSRVSDLLAGSRISTF
TAAVQAGTESALSPLERQTFNEHGNKLMATAATTLTLSREILDNFYERHRAMLVQFGAML
NANPVQVDRRQVQFDMSAFASVREELGQTAKVVAVESSDALHELQTAITSRAGALASMLQ
SVNVELSRTFSSIRAQTFKELTAISATVDSLPSAVAMVARGVEDELAAFADESERQFAVL
PDVEADAVALFVAAFRAEVGVIRERLTETNLLVSAIEQAIQVQADILDGAHRTSQATLQD
LRNMDANVREFLSLPPEASLTTLNSATGLRSFRMTASSASGRADLSAQSYIEFLRQTVSN
TQCILR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]