dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|54020035|ref|YP_115608.1| (Mycoplasma hyopneumoniae 232)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 30S ribosomal protein S16 [Mycoplasma hyopneumoniae 232]
Sequence length 88
Sequence
MVRIRLQRMGSKFNPFYKIVVADARAPRDGRFIEALGYYNPQQKFAKVNLEKTYRWLHIG
AQVTQTVRNIFSKKGVFKNFLEQKSSRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]