dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|385778013|ref|YP_005687178.1| (Clostridium thermocellum DSM 1313)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Clo1313_0647 [Clostridium thermocellum DSM 1313]
Sequence length 311
Sequence
MFKKVVAIFTTMVLLIALTVVSCAENTNYIFNGSFELLIDGEPSNWMREAYDKSPGASNF
RVETEGAKFGEKYVTIINNKLNDSRYSQIVLVEENKKYKLSCYIKTENVSEEGKGANLSV
AEQTVTSKRIKGTTDDWEYVELYVITESGVDRIKVTVGLGGYSGMSTGKASFDNVTMEEV
ETIPEGAPRAVVKAQNTKKSSNNSNNTNNTKSSSSQNNENKNELGKVVLVMLIVGAIAVG
VAVYNTFRSNKKVSGNQGNASNNTGTNTNMTESAANKESAGNKEFSDNNESSHSKEDSSD
NSDSDNKESSD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]