dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|385779499|ref|YP_005688664.1| (Clostridium thermocellum DSM 1313)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type 3a cellulose-binding domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence length 486
Sequence
MNRLGIIYEIQGMKAVVLTSEGEFLIIRRRKDMKVGQQVSFENEDIYNVRGKRFLYVAAA
VSSVAAVLVVMFLYFQSAFLSNTDNIYGYICVDINPSVELVIDETCRVLEVRPQNKDGEQ
LISGLELLDKNVEDVVYELINRSISFGFVKADDNRKIVLISGALNDKRNELKTKKENDEA
ELTELLDNIKARVDRIDNIKVRTITATSRERKDALKYGLSMGKYCLYLEAQELNGSITID
EVHDMSISDMIEKLEQMKLALKDEASPKLQTTPTLGGETAQISPESMQHSTVPGLPETPS
SSEKTIAPTLHGTPGVPDEKTLQPSTPTESSEYVQDGTKGLKIQYYSRKPHDSAGIDFSF
RMFNTGNEAIDLKDVKVRYYFKEDVSIDEMNWAVYFYSLGSEKDVQCRFYELPGKKEANK
YLEITFKSGTLSPNDVMYITGEFYKNDWTKFEQRDDYSYNPADSYSDWKRMTAYISNKLV
WGIEPN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]