dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSSARP00000000328 (Sorex araneus 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_4831:121500:127730:1 gene:ENSSARG00000000360 transcript:ENSSART00000000362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 967
Sequence
MRSAGRDPLPRRSPKWRRAVPLCETSAGRRVNQLRGDDLRRPTTMKGKERSPVKPKRSRG
GEESTSRGERSKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSREYDTGGGSSS
SRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPDGGEYKTLKISELGSQLSD
EAVEDGLFHEFKRFGDVSVKISHLSGSGGDERVAFVNFRRAEDARAAKHARGRLVLYDRP
LKIEAVYVSRRRSRSPLDKDAYGLSSSLAGMSVSSHRHAPGGGGGQRSLSGGAALGYRDY
RLQQLALGRLPPPPPPPLPRELERERDYQFYDRVRPTYSLEPRVGAGGGAPFGEVDEILE
NDQRANRTLFVGNLDITVTESDLGRAFDRFGVITEVDIKRPSRGQTSTMAFLKFENLDMS
HRPKLAMSGKFIIRIPIIGYGRATATTRLLVGCFGPWVLAALALEFDRFGTIRTPDRRVD
SLGRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPPVRERSTRTTAAAVPA
YEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLAEESGGRHLDRSPESDRPRKRHC
APSPDRSPELSSSRDRYNSDNDRSSRLLLLERPSPIRDRRGSLEKSQSDKRDRKNSASAE
RDRKHRTAAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPTQKQDSGSASTASASPKLCL
AWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGTTGGKVAQLKITQRLRLDQPKLDEVT
RRIKVAGPNGYAILLAVPGSSDSRSSSSATSDTATSTQRPLRNLVSYLKQKQAAGVISLP
VGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRVFGFEKGERNEKE
IELTVLH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]