dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|114107926|gb|AAI23291| (Xenopus laevis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Unknown (protein for IMAGE:8331231) [Xenopus laevis]
Sequence length 420
Sequence
AFLSERLEVVQQVMARFNVLGSMFQVPETRAQNVSIYYSPKESFKGRLLRRKLSKSDIGS
PSNFKHLAHVGSPSGTSLDSRTDADLKRLFNLAGIKEEHLKDWEMSRKIFAVIEKKGGME
AVRKETLRIAQSEMPDQRSRSRSLSSSNLTPSKRQNSFPVACPHAAKIPVTALPSSPFSY
IASLPRVPPAPRFPPPPPPPPLFPTMSPIPSPPPLSGDFSHVPPPAQSNKISHRTNIISK
PSLTDIPTRPVIPPLPPTLPSVKDSTLVPLSLPPLPTSVHNSSSEFFVPCQPQSLASYQQ
KDMQNASVPLPPPLPLSLKKPSSENVCLTFPSCPAEDLHKSQLKCRMQTENINGEMPQRE
QSLFLDQIRQGVQLKSISQPSKMESSQNSTIVSALMEVIQKRHKALHGSDHETDDDEWED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]