dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|120538016|gb|AAI29683| (Xenopus laevis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment LOC100036932 protein [Xenopus laevis]
Sequence length 404
Sequence
MSGIYSEVAADENTSDSFWMPNNYSSTVKRTEDGHRLCDEIVACFQDRAKIERQYALQME
EWTHKWKPLVDSSPMYGSLLRAWQAFMSATERLSELHTQIQKTLVAEDSEKIRTWQKETY
HRKIFGGFKESCEIENGFHKAQKPWAKKLKKVENSKAAYHKACKKEHLAIVRENSSKINP
ELSQEKLKKLTEDHEKCTQDKEKVKQRYEKSLQELNKYNPKYMEEMETVFDQSQQQEQKK
ILFLKQVLGSMHKHLDITTNESAKTVYGDLNDAIVAVNDQEDLKWWKNKHGPGMIMNWPQ
LKEWTPDTEQQIVKKKTVKETDKVKLYSVTPTESSQNKAPINVPGVRVRAVYDYSGQESD
ELSFKAGDDLTKIEDEDEQGWCKGVTDKGQVGLYPANYVEVISG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]