dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|49257868|gb|AAH74370| (Xenopus laevis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MGC84278 protein [Xenopus laevis]
Sequence length 462
Sequence
MIWPGVGALLLPLLPLALGYLTVTIEPLPPVVVGDAVTLKCNFKTDGRMREIVWYRVTDG
GTIRQKIFTFDAMFSTNFSHMENYRKREDLLYQSTIRLPEVRISDNGPYECHVGIYDRAT
REKVVLSSDNVFLNVMSPPVSIAVLAADSPAPFSRYQAQNFTVVCIVSGGKPAPQVSFKR
DGELIDVVPMLEPPPAAAGLLGNHPSRNLFNRDSDDTKMQKTLSLLDTEERGLSPFTENP
YRVRAADQGPMSSPVTEAIPETVVSLEFPRWVHSTDPAYFFHQMHLPMSDGTVEVRAMLT
WTLNSQVDNEALFSCEVKHPALSMPMQSEVTLAAPKGPKIMMSPTRARVGDTVRITVHGF
QNEVFPEPLFTWTRVGGRLLDGRAEHDGKELVLERVPAELNGSMYRCTAQNPLGSTDTHT
RLIIFENPNIPRGTEDSNSSGSLDSNRLTSVLLILTVIYELT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]