dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|258508796|ref|YP_003171547.1| (Lactobacillus rhamnosus GG)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment copper-translocating P-type ATPase [Lactobacillus rhamnosus GG]
Sequence length 742
Sequence
MMKKDNMNPSQKMKESANDKGQMQMSHHDQMHAGKMTDMSMDHEHMHQQTDMASMQMSHH
DMGHMAMNHSGMDMHMDHGNMDHGGGHMMHMGNLKQKFWVSLIVMIPVLLLAQFMGMNIH
LGVIELPIVFPGSDWVVLVLSSFLFFYGGWPFLTGAKAELQQRQPAMMTLIAMGITVAYG
YSLYAFLMNNFIAPNGMVMDFFWELATLIVIMLLGHWIEMNAVMAAGNAVEKLAALLPNQ
AHVVHGDHVMDMPLSEVQVGARLRVLAGEQMPADGQVVSGNSSVNESLVTGEAKAIRKAE
GDQVIGGSVNGDGVIEIKVTGTGESGYLSQVMKLVQSAQANKSKAEGMADKVAGWLFYAA
LAVGLLAFFLWLPSGAAVAFERMVTVFIIACPHALGLAIPLVIARSTSIGATNGLLIRNR
QALETVKRAQFILMDKTGTLTEGKFTVAKTIAFAGHDQTQVLSVMAALENHSEHPLATGI
KAAAKQQALKLPDAQNVQVLKGIGLEGEIDGQRYTIVNARYLKDHHLAYDEAQADQLAGA
GNSLAFLIQDDQVLGMVAEGDQLKPSSKSFVTALKQQGITPVMLTGDNHETAKKVADQLG
ITDFQAELKPEDKVAQVEAYQKRGVVMMVGDGVNDAPSLAQADIGVAIGAGTDVAIDTAD
VVLVHSDPADILNFLSLAKATNRKMVQNLWWGAGYNILAIPLAAGILAPVGFILSPAVGA
AIMSLSTIVVALNAMTLHLKRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]