dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|85860708|ref|YP_462910.1| (Syntrophus aciditrophicus SB)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein SYN_02414 [Syntrophus aciditrophicus SB]
Sequence length 769
Sequence
MKKSDTSHQMPMLSVIPTQIILLWIAFLIMIILPTPIQADMGRVVATEAQVSEDSQKAII
LHNREEEVLILGTDLKADKSARIIRFIPFPEEPKVQLASPASFESAMDLIKKHGLKFIEQ
TKGGRAAARAVEMRFNQRLGSHDVTVIRINDAAEFNGWVREFLRQKGLQLKREDPKIEAV
VRDYTRRGFVWFVFDFVTVNEQIRFVEPIQYRFKTKELYYPLKTSNTFGGSGMIDLILIT
PGTFCEPLQSYYGGCFGFQEMRATTSSQLENDEMKGIFPGIGQFSKNQNMFIQLMRYQGD
YEFDQDLLGDFGQAVPYAIGHVEEAWGSPWLFPMEENVKDLKERCRLKPDSGPCKAIFWR
YFFNPETQKCEKFVYGGCEGTVPFETKEECVALCEKDGGASSTLKNINFEEFTPSSKHFT
LQIPAGWPREEYDIQRSSLLSGNNKYELTVRAPGQEGLEYLSVRVAWHRDACGTPERFIY
DLLNPRFSSRRADAKVLPLTGPEAKTLEIKKVRQPFQGMNAKPVKAIERYVVIPAHTGFY
VLVYDAPEALFKENKWVFDKILSSFQPMVSLNSKPEPVAEVSDDEYEVYADFFSAEEVRG
FEIPPYFSNTYRARHVYHETSAGKNSDKQTLTHLMESFGALDKSIMEDYREKNKRVRILR
DRMVVPWLEILQTNEPNREGGRGMEQPLTVFPDEVFLSRIGFNEQKDTALFYVSQNGAPM
TGYFVLMVKKKNRWVIKNAVLEDFKIPYSEISPSFQYIQHDISDGKGGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]