dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSCHOP00000008906 (Choloepus hoffmanni 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:choHof1:GeneScaffold_4200:3306:37114:-1 gene:ENSCHOG00000010045 transcript:ENSCHOT00000010081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 840
Sequence
LNSAVTVAAVRRRVWGVALSSPSPQARWRRLLPGWGWRGGGVIYDHGGDCCPXXXXXXXX
XXXXXXXXXXXXMASDVPSLGATIASGNPGPGIQGGGTIIQRAIKRRPGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVP
TCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQLEAADGFLFIVSCET
GRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGT
VKKEGQQSSMRMCMGSRRSFICRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFR
FRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTSVKNSSQEPRPTLSNTIQRPQLGSIA
NVPLEMGSGQLVPRQQQQQTELDVVPGREGLTSYNHSQVSVQPVTTTGPEHSKPLEKSDG
LFAQDRDPRFSEIYSNINADQSKGISSSTVTATQQLFSQGNTFPPNPRSAENFXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVASQATAKTRSPQFGV
GNFQTPSSFSPMPLPGAPTASSGAAAYPSLTNRGPNFVPETGQSAGQFQTRTAEGVSVWP
QWQGQQPHHRSSSSEQHVQQPSGPQPGQPEVFQEMLMLGDQNNSYNNEEFDLTMFPHFSE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]