dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSCHOP00000010649 (Choloepus hoffmanni 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:choHof1:GeneScaffold_308:11261:99001:1 gene:ENSCHOG00000012043 transcript:ENSCHOT00000012080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 3391
Sequence
MLINIKGLLWMCSTLIATHALHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVFHYRAATSRYTLNFEAAQKTCLDNGAVIA
TPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRTPREGCYGDMMGKEGVRTYGFRSPLETYD
VYCYVDLLDGDVFHVTAPDKFTFEEAGEACENEDGRLATVGELHAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPTPDSRFDAYCFKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDFTDSYQDTTKY
DGGITPVHLTHSALNMEVVTVSKWSRDEDNITSMPLVSTKHEGSPKLSPALLTTVEVNGK
DEESPGFTEHGRDEYTLILDSTQKPLEKFTEYYLREHGKFTVGFQPTASNGIAEKSTLRD
STTEERIPSITRTEGQVVYATTEGSASGEGPDVDISKSVSTVSQFAHTSEVEGLAFVNYS
STQKPTAYVETSHTVPLSVIPKKEWGVLIPSVPSEGEVLGEPSQDIHIIDQTHLEAAIST
ETIRTTTEIAQGRTQEEFPWEEQTAEQPVAAPSSTDGMPMEATTPLDEQERNGSAYPFSE
ESLVTGSERVSVLDTTPDGKMEHSMSYPPGAVTEHKVKMDEMGTLLPSMGPRVSLGPGPE
KEFEIEGSSPWEFVSPLSPFSTRDSLLKEETTTEKREKTSVDYIDVGSGFFEKPKVTELP
EFSTIKVTVLSDITTVFSSVDKLHTTSATKLSSASTEKPPLIDREPGEGTTSDMVIIGES
TSRVPPATLDDIVAKETETDIDREYFTTSSTPTTQPTRPSTVEGKATFGPQTVSTPEPPK
GTKFHPDINVFIIEVRENKTGRMSDLSVIGHPIDSESKEEEPCSEETDAEHDLIDEILPD
LPEVIEIDIYHSEEDEEEDEDCANATDITTTPSVQYINGKHLVTTVPKDPEAAEARRGQF
ESVAPSQNFSDSSESDPHPFAMAETELSTAVQPNESKETTESFEITWKPETYPEAPEHFS
SGEPDVLPTVQFHEEEATEGTESVTKRGPELDSLVHKNTETVPLFPEESSGDAVIDQESQ
KMVFSRTTEVTFHEETEKSTSVTSAPSTASSSGAATISEEESTSLTGSPLPDDRLSTIEN
WLEITPRKIVELLGSPSIPSPEGSGEEEEDKNEMFTVAPDTSQKSTTNTLTTLDTGKRMI
TESILDVSATTIYSVSEQPSAEVVPAKFVKETDTPEWVFSTSLEGKKRNDEEEEKSPQTV
STDERHSPTQRSDQLILLSELESSSESPSSDLIYSTRKSVTSSTASTQSEKEMTSSTLVL
TESNVVDDFGAQATGQSSSSQPRVQEALTTAPSSPVSPFLEQSSGEAAVDPETTTLSSFS
LNLQPGIQTQKEATGTLSIHVENSFPFEPTGLVLSTVMDTQVAETISQTSKENLVSEVPG
EPNLGAEIRVFSTDFPLEEEFSGEFGEYSTVSHPIRKEEAIMMEGSGSSIFMDTQISTSA
IPTSDYINHIPDLERPSSTQVSTSAFPWEDFTTSAEGSGEQLESISSSVDQVLPSAKGKV
SGTDNPFIDQGLEEMIAVKEADKKSTILPMAEAQGTEAPTGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTTGQ
GSDTFVSDSSLEKLHEAPSTKAVSVDGFPTVSEVLPLHSEQNESFLDPSSTSAMSYEMST
EGPEGSFQDSFRGFEDSTLKPDRRKDTENIIIDLDKEDKDLILTITESTILDSLSDLTSD
KNAIIDIDHTTSVYEDILGMQTDTDAEVPSEPHSSNEEISQVQEKYETAVNLSLTEEKFE
GSGDALLSSYTQATHNESMISEDGSQLDHMGFITTGIPVPSIETELDFLLPTAASLSIPS
KSATVNPETDEPKIKAKTLDDIFESSTLSDGQAIADQSEIISTVGHLRRTQKYEEKKYVG
PSFQPEFSSGAEEALVDHTPYVSIGTYLMTQSLTEAPNVIERSNPPGYTETTPAVSASVK
LSSQMLPSPVTIQSGSGASEPTEVLEPSALPGTDVDTSQMSPEDSFKEAHATIEATFKPS
EDDFHITAPPSLSPDVEEESNLKIFEEVEASATELIAEEGTEVPQDSQNQTNVQLSGEAI
KEFIFIGTSEAETVVTSAGEIKLEGASQRPLSTSASATHGVEPSVVPQPDPQTSEGPTVP
SSLEINLKTQASLIRGEDSTVAAPEHQISARVLDSNNQVTESTVELSTEPTTPPFSLLET
SNETDFLIGINEESVEGTAVYLPVPDRCKTNPCLNGGTCYPTDTSYVCTCVPGYSGDQCE
LDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFA
HRRTWDAAERECRLPEDHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTL
KYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENA
KTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMNPSAYQRTYSKK
YFKNSSSAKDNSINESKHDHRWSRRWQESRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]