dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc03g113410.1.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch03 gene_region:57616872-57617695 transcript_region:SL2.40ch03:57616872..57617695+ go_terms:GO:0003700 functional_description:"Auxin response factor 9 (AHRD V1 *-** D7R605_SOLLC); contains Interpro domain(s) IPR011525 Aux/IAA-ARF-dimerisation "
Sequence length 199
Sequence
MDKIMEEEDSFHSNTDAIIYPISDVSQSLLSDPNIASSPSTSADDQQQQPHQWTTAAAAA
VGYSNDDLSVSVSVSSACSRISYKQIDKDQIDVSKAKERVQLPKDFTSSRSRIKVHMQGV
AVGRSVDLTVLRGYDELISVVEEIFDIKGELSPRIKWQLVYRDDEGDMMLVGDYPWPEFC
EMVRKLYIYSREEVKKKYS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]