dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc03g121060.2.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment genomic_reference:SL2.40ch03 gene_region:63350693-63353201 transcript_region:SL2.40ch03:63350693..63353201+ go_terms:GO:0003700 functional_description:"Auxin response factor 9 (AHRD V1 *-** ARFI_ARATH); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence length 287
Sequence
MEGYSQKWLMQRGEEINHGNSEEKKLELRLGPPNGDWSCGEKDESFYPFSYMSTTKGNNR
DNHAQNFSSFLQLQSTAQKQSQRVQESVCTKTADLQSTEKKKAFSQTATVQNSAQKRTAP
APVVGWPPIRSFRKNLASSSSVKSASETQNVVPNKSANKKPMEICQKGLFVKINMDGIPI
GRKVDLKAYDSYHKLSSAVDQLFRGLVAAQNDSSAGGNNEKKEDEEKAISGLLDGSGEYT
LVYEDNEGDRMLVGDVPWHMFVSTVKRLRVLKSSELSTLTRATKQLT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]