dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc06g053840.2.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment genomic_reference:SL2.40ch06 gene_region:33205276-33206566 transcript_region:SL2.40ch06:33205276..33206566+ go_terms:GO:0003700 functional_description:"Auxin responsive protein (AHRD V1 ***- D9IQE6_CATRO); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence length 190
Sequence
MECVLAHEKDLNLKATELRLGLPGRTDEESDKEIVFHFKNNKRALPEDEDCESNSISDPK
TPPVAKTQIVGWPPVRANRKNSFPSKKAEAECGMYVKVSMDGAPYLRKIDLKLYKGYPEL
LKALEKMFKLSIGEYSEREGYKGSEFAPAYEDKDGDLMLVGDVPFEMFLSSCKRLRIMKG
SEARGLGCGV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]