dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc06g071750.2.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment genomic_reference:SL2.40ch06 gene_region:40585640-40586725 transcript_region:SL2.40ch06:40585640..40586725+ functional_description:"Octicosapeptide/Phox/Bem1p domain-containing protein (AHRD V1 **-- D7LRK8_ARALY); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence length 193
Sequence
MSQSTQIVKFLYSYGGRILPRPSDGTLRYIGGFTRVLSVDRSISFAELMVKFGELYGSSM
RLKCKMPTEDLDVLVSITCDEDLANVIEEYDRVSAMTNTEMKIRALLSPINLPKKDSRPS
SPMSCFDFAASSLKPGKFVQFNSPPSYAAARRLFSPVVGYPTGRRTDGEELYYPYCGQAG
VKPLYNVVPIHCQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]