dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc07g007390.2.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment genomic_reference:SL2.40ch07 gene_region:2125803-2128660 transcript_region:SL2.40ch07:2125803..2128660+ go_terms:GO:0005488 functional_description:"At1g62390-like protein (Fragment) (AHRD V1 *--- C0JCT9_9BRAS); contains Interpro domain(s) IPR011990 Tetratricopeptide-like helical "
Sequence length 778
Sequence
MGKESWTKSKKIGGKSGESSSPRAFDKDTAVFIAMSKELKDEGNKLFQKRDYEGAMLKYD
KAIKLLPRNHIDVSYLRSNIAACYMQMGLSEYPRAIHECNLALEVTPKYSKALLKRARCY
EALNRLDLAQRDVNRVLEMEPNNLMATEIAERVKTTIEERGIGVNDIPVDLIPVPEYVEP
TFVSSHSKSSKEKALKKKIKKVEEKMVNGKAEEKEFDAGVDLKQTDNRNEERNTEDQNEN
TDKDQTKEEKVDDKTEGNKAENKTNRKKAKDKSKEKKNKDKIEVNKVKDRFEENKDEDNE
ERKTEDKLVVEEIISHTTEEEPKRTVKLVFGDDIRWAQVPVDCSILTLREIIGDRFPSLK
AVLIKYRDQEGDLVTVTTNEELRWAEASVGHGSIRFYIVEVSPEQDPFYEKIKGVEDDHK
YNARHDKIVENGNVETSKELHNGPVCINDWIFQFSNLFKNYVGFESDDYLDLHEVGMKLY
SEALEEAITSEEAQYLFSTAGETFQEMAALALFNWGNVHMSRARKRVYLKEDSSGESLLA
QIKIAYDWALKEYSKAGERYEEALNIKPNFYEGILALGQQQFEQAKLSWYYTISTGVNLD
SWPSTEVLQLYNSAEENMERGMQMWEEAEEQRLNELSSTNKLQKMKSENLFKGISADEAS
EQAANMMSQINLLWGTMLYERSLMEFKLGLPLWQESLEVAVEKFELAGASPTDIAVMIKN
HCSNSTATEGLGFNIDEIVQAWNEMYEAKRWERGVPSFRLEPLLRRRVSKLYHALELA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]