dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc08g008410.2.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment genomic_reference:SL2.40ch08 gene_region:2829724-2834799 transcript_region:SL2.40ch08:2829724..2834799+ go_terms:GO:0003700 functional_description:"Nodule inception protein (Fragment) (AHRD V1 *-*- B4ER15_MEDTR); contains Interpro domain(s) IPR003035 Plant regulator RWP-RK "
Sequence length 1008
Sequence
MSEPGGGMTQNHLPKSKELTPATVTERESMMMDLDFDIDASWSFDQIFAAAAAVSSNPAS
PFLPCSPLWAFPDDNDEKPAGNGLSGALRISGHPRFVAYTGDLEATTETISVNTDKGRLT
SPISGLLPGDNPEGSCIIKERMTQALRYLKETSGERVLAQVWAPVKEAGRSVLTTSGQPF
VLDPECNGLHQYRTVSLMYMFAADGETDGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRL
DHALNYNVRGTLALPVFEPSGRSCVGVLELIMTSQKINYAAEVDKVCKALEAVNLKSSDI
LDHPNTQVYVMGYMNQICNEGRQNALVDILEILTAVCETYKLPLAQTWVPCRHRSVLADG
GGLRKSCSSFDGSCMGQICMSTTDVAFYVVDAHMWGFRDACAEHHLQRGQGVAGRAYASR
KSCYCEDITQFCKTEYPLVHYARMFGLTSCFAICLRSSHTANDDYILEFFLPPNSGDYSD
QPALLNSLLLTMKQHFRSLSIASGEELEHDWGSVEIIQASMEEKIDAKPESVPTAKTSPQ
LTSLPNGWVHLDPVGEQQSAVGSNVSKGARSTSGTGEAPNNVSNSDNKTSGKKSERKRGK
AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKVNRSLSKLK
CVIESVQGAEGAFTLTSLAPNSLPAAVSSISWPAGANVSNLPSSPSSKPSVFPEEKNEFF
HHGTPESHIEAEPSNQMLGGRVARKEEFTPMQNGFLHAEGTHKSRTGSVSREESAGTPTS
HGSCQGSPCAGNGFSPQNELVNSPAHESCMKVGGSLEAARQTTAEINLSSAFLMPQPIIP
KHTQEPFGGMLVEDAGSSHDLRNLCSPRDALVDERVPDYNLTNPPFSDAIAKDPVYVPPD
TIQQYSAWPEVTSVTIKATYKEDIIRFRLCLSSGIVKLKEEVAKRLKLELGTFYIKYLDD
DLEFVPISCDADLQECVDISRSSGSSIVRLLIHDIMSNLGSSCESSGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]