dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc08g016290.1.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch08 gene_region:7058200-7060690 transcript_region:SL2.40ch08:7058200..7060690- go_terms:GO:0008270 functional_description:"Mutator-like transposase (AHRD V1 ***- Q9SLM0_ARATH); contains Interpro domain(s) IPR018289 MULE transposase, conserved domain "
Sequence length 743
Sequence
MTNIAVMLYFNGRWDPSNKYINYLADGVLIHTESTFATLVSVIATQLSIDTSTSKVEIRY
KIDERSPPIQIHNDMGVKVYLETKKEHRDMTRYPLCVTTTEPVNLETNAALIPLLCSDTS
GDMRVIHNSYFSNTFNGIDEAIGLIGFGSCEEVDELEELAPGIIINPNHSLFEKDQVYKN
KYVLTSALKRHSILNHFQFKTTRSSAISYSIQCLGESCSWSLRASSLNKSEMFKIREFES
EHTCLLLHNSLSERLATKSVVGSIIVGKYAEPDANYTPKDIQRDMLAEYGVRLTYMQAWR
AKEAALELIRGDPIQSYAKLPSYFHILEATYPGSHIRFHKSEDDRFLYAFVALFTSIKGW
EYCRPIVVVDGTFLKGAYKGTLLTANTLDAAGSILPLAYAIVDSENDSSWGWFFEQFRDA
FGQRPEMCIVSDRHASIIKAVSTVYDEVPHFACMWHLLQNIMKNFRRSQQRVTELFYSMA
KTYTMTEFNQCMTMVEKIDKRIKDYLLNIGYNKWSRVHAEVNRTWMMTSNIAESVNSRTR
HAKVLTVLQLLEFMRQLVQKWNNNNRSKATFSGFHLGKKYENILRRNKTASEKLKVVETN
KYVYTVLDGITQFTVCLHQRTCTCGRFQLDELPCPHALAVLTIKHTGYEKYCSAYYTRKN
LLLTYQFQMDPLPNESTWNTPTHVLQDIVLPPHGKRPPGRPKNKRHTQLREDGFKKAKIT
CSNCGQHDHNRKTCKNVRPYDQE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]