dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc11g069500.1.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch11 gene_region:51188434-51191569 transcript_region:SL2.40ch11:51188434..51191569- go_terms:GO:0046982,GO:0005516 functional_description:"Auxin response factor 16 (AHRD V1 ***- D9IVB4_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence length 699
Sequence
MKEVLEKCVDSQLWHACAGGMVQIPPVNSKVYYFPQGHAEHTLMNVDFSALPRSPALILC
RVAAVKFLADPETDEVYAKIRVVPVGNKGNDFDDDDDILGSNESGTAEKPNSFAKTLTQS
DANNGGGFSVPRYCAETIFPRLDYTADPPVQTVTAKDVHGESWKFRHIYRGTPRRHLLTT
GWSSFVNQKKLVAGDSIVFLRAENGELCVGIRRAKRGGIGGPEAPSGWNSGAGNYGGFSA
FLREEMSKNGNLTSPTRSLRGKGRVRPESVVEAAYLASSGQPFEVVYYPRANTPEFCVRA
SSVNAAMRIQWCSGMRFKMAFETEDSSRISWFMGTISSIQLADPIRWPNSPWRLLQVAWD
EPDLLQNVKHVSPWLVELVSNMPVIHLSPFSPPRKKLRLPPDFSLDSQFQLPSFSGNPLR
SSSPFCCLSDNITAGIQGARHAQFGVPLLDLHLSNKLPSGLLPPSFQRVAANSQLPNVIN
KCQNDRNDNISCLLTMGTSSKTLDKNDSVNTPRFLLFGQPILTEQQISNGCSVSAPQVVQ
TGKDLGRIQPINEKHPSEQKGSIQDNLSSATFFWNRGYHAAELGVLNTGHCKVFLESEDV
GRTLDLSVMGSYEELYKRLANMFGLERPDMLTRVLYHDATGAVKHTGDEPFSDFVKSAKR
LTILMNSSSNIKRKWLTGLATAERGLDSSNQAGPLSIFA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]