dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc07g032110.2.1 (Solanum lycopersicum v.2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment genomic_reference:SL2.40ch07 gene_region:35135676-35139982 transcript_region:SL2.40ch07:35135676..35139982- go_terms:GO:0030276 functional_description:"Clathrin binding protein (AHRD V1 **-* B6STF7_MAIZE); contains Interpro domain(s) IPR001452 Src homology-3 domain "
Sequence length 370
Sequence
MESIRKQATKLREQVAKQQQAVFKQFSSGLGGPDNSVTDEVELQQHQKLEKLYISTRAGK
HFQRDIIRGVEGYIITASKQIEIGTRLSEDSRKYGAENKCTSGSTLSKAALSYSRAQGEI
EKEREDLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRVRQEAEAQAIEVSRRQAKVR
ESNGNPESVSKMEAAEAKLKDLKSNVATLGKEASTSMAAVEAQQQRLTLQRLIAMVEAQR
HYHERVLQILDQLEAEMMSERQRIEASPSSATDNTMPPPPSYTDVNGGLHFKSYDGSIDG
TTYYLAEVVHPYEAESDVELTLLIGDYVVVRKVSNNGWAEGECKGKGGWFPFGYVERRER
ILATKVAEVF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]