dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc08g006190.1.1 (Solanum lycopersicum v.2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch08 gene_region:894407-897998 transcript_region:SL2.40ch08:894407..897998+ go_terms:GO:0003700 functional_description:"B3 domain-containing protein Os03g0212300 (AHRD V1 *-*- Y3123_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence length 544
Sequence
MKFAPKKPHFFKPILPNFKHGIKIPVAFCKHLKGCNQEHAILRKSDKKWQVKVNGRLLDE
GWAIFAKENDLQLGDCLIFRHEGDFEFEVSIFGSNHFERVYEQTPKGGEEINHTCNKIIS
QAKTTEKTKLNVKSNEIIPEVEAAENMPLDRPPFIFTVTPYCLTRGHVQLPVQFARDNSL
MNRRCTITIRDEQRSLTFALYSSGARTYIKGQWREFCIANCLKKGDQIMLAIVDNGMNPV
LRFYGNSDVIIFNLKLDLRTNASLQLEVKKPNLDAEEVSSRKEVATVPASTSANANAQFV
SIIHPYAIIRALFYLPLSFARPNGLMRRCKMILKDEKQRSWSVQLEEVGPRFAITKGWRQ
FREANDVQVGDTYKFELIHNGTTPVAYFHRTRANASVQPEEKKPNLDARRVSARSNEADV
PASTCDNANTQFVSTINPHCINSPFIYLPSAFAKSNSLVNRRCKMILRDEKQRSWSVVLA
PMGHHTAITKGWRQFREANGFQVGDTYKFELIDNGTIPIAYFHCEYIYFPSFHYVPPCYA
TLFQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]