dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

AC01838-PA (Atta cephalotes v1.1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ACEP_00001838-RA protein AED:0.00925704888464496 QI:0|-1|0|1|-1|1|1|0|638
Sequence length 638
Sequence
MGVSVFLLYAVTVLGVAASDNCADKCSCKWKSGKRTVECVNRDLTSIPEWIDPETQVLDM
SGNNICHLPNNIFIHVRLTNLQRLYLRECRIDRIDSEALAGLTNLVELDLSNNMLAAVPS
LSFTDTPFLRDLVLAYNPLKRIRSHAFKSTPNLVKLDLSHTQLVEIEAKGFRGLEMLESL
KLSNNELSTLHPGTFEPLNKLTSIELHENPWICDCHLREMKMWLVKHNLPTIVAPVCHGP
QQLLDRAFTDLGIDDFACRPILLIASRYAEATIGENASIVCRVSAIPPADVKWYWNGRLL
TNHSAFSSYQKILIFEEGQFRKRSTLILTNAQEADSSEFYCVAENPAGSVEANFTLHVSL
RTAGMSTLGSGQIAGISAALVVLILFILLIILVLFIRLRRMPLKDMKSSAPMEAASSDGN
GGNGGGGGGGGGDNNPSSATSTTRRKHEEIETTSFALESKPPASLHLSYVQRPHAAVMQE
SEYSTISRFDDQNQPAVAAMPGAGCFSSTTSLMPIDNPDLIRDTRRGSTEDITPYGVADY
GRVEALDDAGKMLYTSCLWEARDSCGRTSAVSANMYPSKEQLAVVAPVVEQFPPGAKQMR
VWQKGVPVLPPVSALKRVLGSTRSSPDEGYQEGTGTDV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]