dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Cflo_05996--XP_392454.2_APIME (Camponotus floridanus v3.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment [mRNA] [translate_table: standard]
Sequence length 1762
Sequence
MLIGLETCLELAVPFTRYFNGRLRLKIKFDKHPDYIVETEKKIYIEHDSIITFVETDKPV
YKPGQDVNIRILMLKHDLKPWKKTIPKVWIENPSEVRVAQWTNVSTENGMTQLKFALSPE
PSPGAWKIKVEKTRSQPQLIHTTVFEVKKYVLPRFQVTVTSPGYILADAENVTWNICAKY
SYGKPVKGRLLLKSTPQIPIWRRKPNLPEIHYETELDSSDGCTEFVLSGAVLGLAQWKVA
PNNIVLIANFTEAGTGIVETTISRTVVVHQALKLEFLPYTPKYFKLGLPYHGKLRVSRHD
DTPAPHEKIQLCVRVRGEDDWLRVVVECRNFTSSSDGFVDFVVPPPHRNIVLLNFIATGV
DYPTKYYSPDTRWRVFMDQPSAHIVVNPWYSPSDSYLAVARGYQPIICGEKYSFNVMYTV
PAKSKTNESISFHYSINSKGDLLIYGHVKHKPTRDMVLNYSEFRNLFGAVETSGNKTNQD
TIVHRFPLSVKITPSMAPVSELLLYYVRPDGEIVATTYSIKVGHCFENKVKSAWHTDAQT
PGTVTQYHVEAAPWSLCGISAVDKSTRFLGSKANLIDADQTFEQLKRFYIEPELRPIWTQ
CKVTTQQETNTEEIDHLPIPLWGRRKKRTVISPGPYSGLTNYVDAIQAFDDFGAVVMSDL
ILETRPCPQLHRMDRFRSSTIQTFFLRSTSVLESEAGMFKMAAKTLPMAYPLLNEGPEQA
YVDQVPDQPATLRSYFPETWLWELVPTGKEGKVAIERTLPHTITDWVGYTTCISSTHGLG
IAPPTTITGFQPFFLDYSLPYSVKRGEMLHMKVSLFNYMQHSLPVKIKLEDATGLDLHLS
HAVASFCVKPRDSVVHEYILRPRVLGDVNITVSASVDSEYGEPCGPEVLLYTRDVIVKSI
LVLPEGFPVEATKSAFICPKDFSDDSTITWHLDLPDDLVPESARGYVSMIGDILGPALEN
LDNLVRLPMGCGEQNMILFVPNIHVIGYLDTTGVENPELRAKAVRNMEKGYQRELIYRHP
DGSYSAFGPNVTEDGSSIWLTAFVIKSFAQAKNIIHIDERDLKISVKWMLKKQLENGCFP
MIGRVFHKDMKGGLQDDDSSSSALTAYILISLLESGVPLTATLINNALHCLEKGMENGGG
TTYTAAISTYALSLLEHPKANNSMKLLMERATRNNDLLWWEDKPSLGLSIEMTAYAVLSL
VKLGGEANMVEALKAVRWMSKQRNAEGGFTSTQDTVLGLEALTKYAAAMSNDNTDLSVLV
TGNEVDQLYRMHNDNRMVLTQIRLPVIPTIIEIFAEGEGCVLVQSNIKYNVAHATGSEAF
DLSVNAASSTWVDECSMQKITICTRYKMADGESNMAVLEVGMISGYIPDRTSLHSLLEDP
ATKVKRFEEDRDVVTIYFDKLINQKTCISFMVTRENVVDRLEPANVKLYDYYQQELTISS
SYSFAPTCSSATPNEETEIPDPVPVEVEQLDKDATKIAKKDERIEKAAEIPDAQNGTVEQ
IVPRAEIGSGQTPDEPDINLNPVFDRLGPPNVDLEDMEASFSVFNGQNQDPFPANFDGNP
LFVVVDHELATPDGVEGPVSVSVKPDINFDGDQLSNVTNQSAERIDTDSSNTQLQTSPPL
ASNESCPICADELPLNINEIYCSSSSVVKAAIRRLRKVRLLLDIQPLHEIKRLRSTVEFI
LNPKCSCSPLDNPGTLALLMHSGDSEFAIRSHNSQHIRVVALDERTSIYGLQSHSGVPDE
LINARKICATRDKTSLNLPTTG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]