dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTGUP00000012846 (Taeniopygia guttata 76_3.2.4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:taeGut3.2.4:1:62974115:63064038:1 gene:ENSTGUG00000012476 transcript:ENSTGUT00000012992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 741
Sequence
MAERARAALSESGWCLSDEGIEACLSSSEKVNTNDIILVALNTDLRTIGKKFLPSDINGG
KVEKLEGPCVLQIQKIRNVAAPKDNEESQAAPRMLRLQMTDGHTSCTAIEYSSMSKISLN
TPPGTKIKLSGVVEVRNGFLLLDDSNTAVLGGEVEHLIEKWELQRSLAKHNRSNIGTEGG
PPPFVPFGQKCASYVQVDSRDLDRRKTLQMTNAVKPVADNDEFEKQRTAAIAEVAKSKET
KTFGGGGGSSRSNLSVSTGGNRNRELFQKEKIAKPEGKNEGVYRELVDEKALKHITEMGF
SKEAARQALMDNSNSLEAALNFLLNNSKQKPIQGPPPRGKGKGRGRIRPEDEEELGNARP
SAPSTLFDFLESKMGTLTVEEPKLQFQPTHQVQHKVMNTEQNGIKENHSRHVSRNDMRQP
RNEKPPRFQKDFQNSRQALESGGLPRNRGPERHSSLEHWTDEKNKSDRHYPRNDRSKDLS
YPISTHQSDSTFKKRDNNMQNRVGKGVSFSEFKENSAAQDVTENNNQKRGKRENQTHNSE
NFCDRKARTISTEAFMVKREQHFGVNNDYQNPSRTDNFSAVPNGDTEHHQKGRRVGPIKS
SGPTAIPSFDDKMLYYNTGPKRRTGPIKPEKILEPSSHMEYGKSWRPGDECFALYWEDNK
FYRAEIEALHSSGTTAVVKFSDYGNYEEVLLSNIRPVHADTWEEEEETYEQTLEFRRGGD
GQPRRSTRPTQQFYQPPRARN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]