dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

pbar_krimp-1 (Pogonomyrmex barbatus v1.2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein AED:1 QI:0|-1|0|0|-1|0|1|0|1160
Sequence length 1160
Sequence
MQPVTTESAYRFTIKPAVTIGNPILEAFPEEAQRRRFPTFILRNFSRYLTKITPKSKDNN
LSSQYKLQNTELERYRKPDPKNCGNNVKICHLIVNQILSQLNDKSQIPKPLELSDNLLKS
LEIYKRTFPFHLQSVHLQSADSDQKMTGESNSDCTPKKSNTSNAIVNVLYGSKNDKYTST
KDVSKSNNSIIRNTLSKTKTDYQNNLDINNAKTMNYLKNGTSEAKKDIYNEKMSKKNNHL
LPPEKSTDTQRNNKWICKLIGDKFTACRQYNSTKVLNKPSNMTISIITAVSNNVDTNLNF
NATNVSDGNKIMKKTSSRKYGPAYQEYYNKYLKNYSTLSSTIKTIESIDMRASTIKSTLL
KGADEYKITEAWKTEKEDTTTTVKSTYFNTSVDNIYKQKLQNYIKTRNNNMNSRDNFFGH
KVKKDGKAAYYFNKYLKQHHVTRRTISVEDMDEIVEYVTANIQYNQTMKEAASSLSKEMS
ARPKASKNDYSSIKTEKLLYESNSPKVEIRRHFQAINDIDIVSNLSSSNNSIQQNYDRDN
EKRNMSKTHEQSGARTFETFNESNGNSTRNEDKIDSGLINSDETPESITANDHTTAEESR
ESKETLEESSRDDFDVLILNLTTTTRAPEIVTRDANESREVTSTESHGKREHKSRHNGRK
NNRPKKKKKKKNRNAKRKGESTLAWEVDKPTSVDYGNASEQTKTTFSHNDPGYDKVDNNR
NTSTGRNDWNFTDEITTESIKGEFSNTDGSVSEHPTENNIHNSLQSEKTTDADLVTTSQL
LTTSNGESSKKCKIRITTTTENNWFFRWISDEKIDEESNECEEDVVSTTSNSIDEKTSYY
STSISDDSSTYNKVSTLDGTTWKSFSNENDDISSEEMNTSKNEEDNDREDTIRKPILDEE
SNEDNEAIEYLESITHFIRGGATTDVNLNLDSEEEEEEYAGQEKFISSEDNDIDNGPVNA
DDYENDHCNENQHACDKYMCIEEDQLCDGIVDCFNANDETDCDYIYTRRLEEHLRVNKEQ
NELNSFSNEDTSLDGCDLYEHPCDGKCINALNVCDGKRDCLDGTDEGNCTEGILNIENNI
LQEKSVGFALRLRCKKFLALNGTRTSRGISSQRDVIFETTCHLRCIKTGFKDIRLVNTWT
FLGNCRDPIGKKDLRMLLFN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]