SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150015524|ref|YP_001307778.1| from Clostridium beijerinckii NCIMB 8052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150015524|ref|YP_001307778.1|
Domain Number 1 Region: 537-846
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.2e-74
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0005
Further Details:      
 
Domain Number 2 Region: 40-335
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.73e-58
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00047
Further Details:      
 
Domain Number 3 Region: 336-519
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.62e-42
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00012
Further Details:      
 
Domain Number 4 Region: 845-1078
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 4.58e-42
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150015524|ref|YP_001307778.1|
Sequence length 1085
Comment 5'-nucleotidase domain-containing protein [Clostridium beijerinckii NCIMB 8052]
Sequence
MKKLLKFRKVISIFTSLFFIITLFSSFSIRVYATENEKMFDVIEITDFHGTLNDSSGNQV
AGVLADRIEKVKESNKDRTLILGGGDLYQGSATSNIMKGVPVQETMSKIGMEITTLGNHE
FDWGLDTTTNTTMKGAAYSIVCSNLYDKKTGKRVFDPYKIITKDGIKIAVIGGITRETEM
SVSPKFVSDYKFTDLASEINPIALQIKKDKLADVVIVLVHEGDKGDNATGPVFDLANNLQ
NVDAVFGGHSHTKTAAIAKNTNIPVYIGGSNGKGYIDAKFKVTSDNKIVFDQPNLETSYV
ALDNDKGYKTGTPQTDSDVDKIVDNANKQIEPMTSEVIGYNTEKDLTRKLDASPYGSSVL
GNWASDVTRNSIKADVGFQNNGGLRIDIPQGNITVGTMWQFMPFDNTIYKLSMTKSQLKE
VLEQAVADNSKGLQVSGIKFGYDSNLPSGQRVKSITKEDGTPISDNESLSVAVPDFVAQG
GDSFTAFTKYGGLDVKNDTHVLVRDAFIDWCKENKDKNDKNTIPNTDIPRMVNMSSSITL
LATTDVHGTVLNYDYGTGKAPSKAQGLAKVSSYVKSVRENNNNVMLIDNGDTIQGTPLSY
YYDILDTTLEHPMAKVMGAMKYDSWTLGNHEFNYGLDVLNRVIKDYKSEGIEVLGANIYK
NDSTNFVDPYIMKSFYVNGKEVKVAVIGLENKCIPSWEDKKHYDGLVFNDLVDESKKWVK
EVKAKGADVVIISAHSGQETDADVIPENEINAIATQVDGIDAIIAGHTHLKVNDLTKKNP
EGKVVPIVESTKGATGLAQVDMNFDGNAKLIGISTKNIVIDNSIADDQEIVDLIKPYEDT
TLKYVDTKIGTSTGEFTGSGQLTEPTAIMELINKVQKESAGTQLSIAAPLSSGAYIPQGD
VTIKDMMAVYVFENFLYGVKMTGKQLKDWMEYSVRYYDQTTGDNAAVIKDPILNIPDYNL
DQLYGATYDIDLTQPACTIDKETGRVISGNRIKNLKVNGVEVKDSDEFTVAINNYRFNGG
GGFMKAAGLSNTDSSIIVYDSGKALGDDGQVRSLMTSYIKKHGEISPDCSNNWEILNVDK
QKKAA
Download sequence
Identical sequences A6LR42
WP_011967983.1.44456 WP_011967983.1.51202 WP_011967983.1.88565 WP_011967983.1.91641 290402.Cbei_0635 gi|150015524|ref|YP_001307778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]