SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060138|ref|YP_003138026.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060138|ref|YP_003138026.1|
Domain Number 1 Region: 80-305
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 6.41e-83
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000372
Further Details:      
 
Domain Number 2 Region: 8-80,306-514
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 9.29e-75
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257060138|ref|YP_003138026.1|
Sequence length 532
Comment phosphoglyceromutase [Cyanothece sp. PCC 8802]
Sequence
MAQAPVSPVVLVILDGWGYRQSTEANAIALAKTPVMDCLWTSYPRTLIHTSGKDVGLPNG
QMGNSEVGHLNLGAGRIVPQELVRISDAVEDKSLLRNPALVNICQEVRDRQSKLHLIGLC
SDGGVHSHLDHLIGLLELAKEQHLDQVCIHVITDGRDTNTNEGINAVAKLESSIKEIGVG
RIVTVSGRYYAMDRDRRWDRIQKAYDVYTQDRPGDGRSATEVIKDFYKNSITDEFIEPTR
IAPGAIKSGDGVIFFNFRPDRARQLCYALTMPNFDGFERELIQPLSFVTFTQYDPKLPVK
VAFEPQNLNNILGEVVAREGLKQFRTAETEKYPHVTYFFNGGLENPFEGEDRELIQSPMV
ATYDQAPAMSAETVTDTACNAIEKGIYSLVVINYANPDMVGHTGNLEAAIQAIETVDNCL
GRLLTSISKMGGTVLITADHGNAELMVDENGNPWTAHSTNPVPLIIVEGEGRKIPGHGGA
VDLADNGRLADIAPTILEILQLPKPEEMTGRSLIEPIHLEIKQNRTPVRISR
Download sequence
Identical sequences B7K189
gi|218247069|ref|YP_002372440.1| 395962.Cyan8802_2315 41431.PCC8801_2264 gi|257060138|ref|YP_003138026.1| WP_012595552.1.62203 WP_012595552.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]