SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954989|ref|YP_731473.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954989|ref|YP_731473.1|
Domain Number 1 Region: 91-317
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 4.71e-75
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000053
Further Details:      
 
Domain Number 2 Region: 19-91,322-526
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 6.67e-70
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954989|ref|YP_731473.1|
Sequence length 543
Comment phosphoglyceromutase [Synechococcus sp. CC9311]
Sequence
MNVPNDLEGNLLRNAPVAPVVLAILDGWGICDSAEHNAIRSASTPVIDALWHAYPHALIE
ASGSHVGLPDGQMGNSEVGHLTIGAGRIIRQELVRISETVRERRLGSISALQSVAERLRR
TGGTLHLLGLCSDGGVHSHVDHVCGLLEWAAEEGLKNVAIHAITDGRDTPTQSAPTHLSK
IQAAISTYGIGRIASLCGRYWAMDRDHRWERTERAYALLTDPDLDRQEDDPASVLVSSYA
KGITDEFLEPVRFSDDPLRDGDALLMFNFRPDRARQIIQALSLQEFEGFRRVHQPTLDVV
TFTQYETDLPVSVVFPPESLDQLLGQVVADAGLKQYRTAETEKYPHVTYFMNGGIEQPLP
GEKRHLVPSPRVATYDQAPEMSADTLTESCVAAIQQGEHSLVVINYANPDMVGHTGMMEA
ATQAIETVDRCIGKLLDAVGRMGGTLLITADHGNAERMQGPDGQAWTAHTTNPVPVILIE
GEKRKVPGFGNSIRLRENGGLADIAPTLLQLLNLDKPEAMTGTSLIEPIEASAPATTKLP
QPV
Download sequence
Identical sequences Q0I7U9
64471.sync_2276 gi|113954989|ref|YP_731473.1| WP_011620185.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]