SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110668507|ref|YP_658318.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110668507|ref|YP_658318.1|
Domain Number 1 Region: 10-200
Classification Level Classification E-value
Superfamily PhnH-like 8.76e-27
Family PhnH-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110668507|ref|YP_658318.1|
Sequence length 224
Comment phosphonate metabolism protein PhnH [Haloquadratum walsbyi DSM 16790]
Sequence
MRALGIDPIHDTQKTFRTLCAVLSNPGTIEQHSVTPVDHAVVVTLVDHELQAQIDDEKLQ
KELDAQGRYEGADVREADIIHTRGVPSWDIRDIPRGTLLEPSDGATVIYRVETLTTISSH
SAVESDNIHQDAVGDDTSITVVTIDGPGVPTKTDRTVAIGLPPEELDRIATAQSTYPRGV
DVIITTAESMLAIPRSASISRVRIEHAQSTVTDGSVRERESEAR
Download sequence
Identical sequences Q18H33
362976.HQ2600A WP_011571828.1.31310 gi|110668507|ref|YP_658318.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]