SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258513390|ref|YP_003189612.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258513390|ref|YP_003189612.1|
Domain Number 1 Region: 4-458
Classification Level Classification E-value
Superfamily Monomethylamine methyltransferase MtmB 8.5e-165
Family Monomethylamine methyltransferase MtmB 0.000000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258513390|ref|YP_003189612.1|
Sequence length 462
Comment Monomethylamine methyltransferase MtmB [Desulfotomaculum acetoxidans DSM 771]
Sequence
MALAKTITVFDIYDRAKSGPKMEEKDWDYKLIPQKAAALKKKYNIKMDKKQIIPTDKELI
NNLFKAGLEMLVDCGVYCIDTNRVIKYTEEEVLASIATAPTKVMYGEGKDAVELSCRSYT
DSRPPIIQGGPTGAPCSEDLFLSIHQSYAQEPLVDTIVDGVLQTINGHDPVPNSPWEIAA
VKSEAIMVRAAQSRAGRPGMGLOGNETSLSPAGVIAADFPGGMRPSDSHEVSQLNELKID
VGALVFTAHYVLTGNIIMCEQMPIYGGYAGGLEETTIVDVATTINSFVMTQATWHLDGPV
HVRWGITTARETLAIAGHCAMAIEANTNLMLGNQYYTLAGPCTVMCLLETAAQAITDTAS
GREVLSGVAASKGVATNYTTGLEARMMAEAARAAAGMETAKVNEILDNLVAIYEKDYKTA
PKGKPFEECYDMVKLVPTQEYLDVYDEAVKILTGLGLTYWTK
Download sequence
Identical sequences C8VVC4
gi|258513390|ref|YP_003189612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]