SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110799312|ref|YP_696630.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799312|ref|YP_696630.1|
Domain Number 1 Region: 635-926
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.76e-79
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 52-345
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.29e-70
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 924-1098
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 8.24e-47
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00013
Further Details:      
 
Domain Number 4 Region: 375-586
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 6.54e-29
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799312|ref|YP_696630.1|
Sequence length 1181
Comment bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein [Clostridium perfringens ATCC 13124]
Sequence
MLKKVRDKKFTALAVATSMIFGIATPLTTVKATENLAPENLEKKGEEASLEKEGDVTIQI
LGTSDLHGRFMNYEYARNQKSDGGLNQISTLVNEARNENPNTIVVDNGDTIQGNFNHLFK
NGPNPMVMGMNAIGYDVFSLGNHEFNYGMDNLNDVVSQANDNLDVLCANLYKDGKRVYEG
YTTREIEGVEVALIGVVSPHIMKWDSENLKGYEAKNPAEEVGFVIDEIENRPEGGADVYA
VVSHVGLESEYGNGDSARAIAEMNPEVSAIVAGHSHTNVPEEKINNAVISQPTSNGQMVS
KIELTVRKNGEKVEVVDKKSKLLSTKGVAEDQKINDLLSDFHNTAIADATAPVGEMVGGD
LADKNEIKEIPQSLVEDQGITDFINEVQLYNSRKHLESKNINPDEVYMVSGAALFSASSN
LYEGNISKADISNIYRYDNKLYTIKTNGKQLKKYMEKNAEYYNTYKDGDLTVSFNEDVRM
YLYDMFDGVSYEINISKEPGQRIENLKFEKDGKPVEDSDVVYLTVNDYRYNSGLAAGIMD
QGEHEKIYDTNNDQISDMRDLIVDYIQNVKGGKITKNIDNNWKITGNDWDSEQRELAVKL
INEGKIKIPVSEDGRTPNVKAVTWNDVLEALGTKEVEIPIVTFNDFHGSLAESKSDVGAA
KLVGEIKRVKEENPNTVVVTGGDIYQGSAMSNLLKGEPVTAMLKEMGLEFSAVGNHEFDW
GYEYIPDWAKAGEFDFLASNIYEKETGKPVEWAKPYGVVEREGKKVGFIGLATPETAYKT
KPDNVAHLEFKDPVEATKTWVDYLENKENVDAVVVLSHLGSEQNRETGEITGEIVEVAEV
PGVDAIISAHSHQKVEGKVNGVPVIQAYKNGRNLGYVNLKFDYKDELVVTTKLDDISKRK
DTLPVDKNMEDILAKFEADLAPIMNEKVADLSVDLPHDRDTGVSPMGATVAETMRRIVDA
DIAITNGGGVRAPLMAGTVTVGDMYTILPFDNTLVTMEMKGSDIIKVLEHGIEPDNFGWG
QHAGVKLWYTPGAERGEKITSVRLADGTKLENDKYYTVVTNDFMAVGGDSYDFSAAKNVV
DTNLVIRDEMANYWRENGIDPITDLSTLLEAGEDTTVDSEKPENPENPGNPETPQNPENP
DNGENLPNTGMPFGTGAVAAMGTVLTIGGLAVLRKKKNNAA
Download sequence
Identical sequences A0A0H2YQ58
gi|110799312|ref|YP_696630.1| NYSGRC-SEC-110799312 WP_011591006.1.50147 195103.CPF_2206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]