SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256421834|ref|YP_003122487.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256421834|ref|YP_003122487.1|
Domain Number 1 Region: 8-219
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.36e-60
Family Prokaryotic proteases 0.000014
Further Details:      
 
Domain Number 2 Region: 191-303
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-16
Family HtrA-like serine proteases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256421834|ref|YP_003122487.1|
Sequence length 308
Comment HtrA2 peptidase [Chitinophaga pinensis DSM 2588]
Sequence
MDAYSQLIIDAVEKASPAVVKIERLERRGNQETVSGTGSGFLFSSDGYLFTNSHVINGAT
RLKVRLQDGREYTATLAGQDVPTDLAILKIDAGEFATVKLGDSDDLKIGQLAIAIGNPLG
FQHTVTAGVISAVGRSLQGQNGVTMDAMIQTDAALNPGNSGGPLINSEGEVIGVNTAVIM
GAQGLCFAISINTAKAIANQLIRFGKVKRAYIGVAMQQIDLVPRLRSIHQIRNKQALFVS
NVERYSPAAKAGILNGDIIFQFNDHLVETADQFFKMLTSDKIGQFQYINVIRDNTLLELR
ITPVERGD
Download sequence
Identical sequences C7PLJ9
gi|256421834|ref|YP_003122487.1| WP_012790462.1.2976 485918.Cpin_2807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]