SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256422488|ref|YP_003123141.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256422488|ref|YP_003123141.1|
Domain Number 1 Region: 142-326
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.79e-26
Family Prokaryotic proteases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256422488|ref|YP_003123141.1|
Sequence length 356
Comment hypothetical protein Cpin_3473 [Chitinophaga pinensis DSM 2588]
Sequence
MAGILDEQPYPWHKKTAQQLHLKLCQFSASVPGILLVAAQSQIEAYNLHTEETPYLLWAD
ILEYAAIHGHLRELITNIANRLSATSPIRSFFQDLLANQDPPLDAEPVGPLGAPRFISDT
DDITENEALLYKEDLTLRIVKVPALINTLQKLTTLAPGVCRFIVEVQGSTQYGTGFLIGK
DMLLTNWHVLHHETNGTKASAATAEFLFDDSHANSSVKIPCDVNTIVTSQEDDWAIIRST
QPLEDNWPIIALSKAVAPQNNIAAYIIQHPGGESKRVGFVRNQVSDFNDRVVHYLTDTQR
GSSGAPVFDENGNLFGLHHAGGRPQTIVGKPPLVKNEGILISKVVEGLKRYEVAFD
Download sequence
Identical sequences C7PTF0
gi|256422488|ref|YP_003123141.1| 485918.Cpin_3473 WP_012791116.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]