SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110803262|ref|YP_699227.1| from Clostridium perfringens SM101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110803262|ref|YP_699227.1|
Domain Number 1 Region: 635-926
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.35e-79
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 53-345
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.29e-70
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 924-1098
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.27e-46
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00011
Further Details:      
 
Domain Number 4 Region: 375-586
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.4e-29
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110803262|ref|YP_699227.1|
Sequence length 1175
Comment bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein [Clostridium perfringens SM101]
Sequence
MLKKVRDKKFTALAVATSMIFGITTPLTTVKATENLAPENLEKKGEEASLKKEGDVTIQI
LGTSDLHGRFMNYEYARNQKSDGGLNQISTLVNEARKENPNTIVVDNGDTIQGNFNHLFK
NGPNPMVMGMNAIGYDVFSLGNHEFNYGMDNLNNVVSQANDNLDVLCANLYKDGKRVYEG
YTTREIEGVEVALIGVVSPHIMKWDSENLKGYEAKNPAEEVGFVIDEIENRPEGGADVYA
VVSHVGLESEYGNGDSARAIAEMNPEVSAIVAGHSHTNVPEEKINNAVISQPTSNGQMVS
KIELTVRKNGEKVEVVDKKSKLLSTKGVAEDQKINDLLTDFHNTAIADATAPVGEMVGGN
LADKNEIKEIPQSLVEDQGITDFINEVQLYNSRKHLESKNINPDEVYMVSGAALFSASSN
LYEGNISKADISNIYRYDNKLYTIKTNGKQLKKYMEKNAEYYNTYKDGDLTVSFNEDVRM
YLYDMFDGISYEINISKEPGQRIENLKFEKDGKPVEDSDVVYLTVNDYRYNSGLAAGIMD
QGEHEKIYDTNNDQISDMRDLIVDYIQNVKGGKITKKVNNNWKITGNDWDSEQRELAVKL
VNEGKIKIPVSEDGRTPNVKAVTWNDVLEALGTKEVEIPIVTFNDFHGSLAESKSDVGAA
KLVGEIKRVKEENPNTVVVTGGDIYQGSAMSNLLKGEPVTAMLKEMGLEFSAVGNHEFDW
GYEYIPDWAKAGEFDFLASNIYEKETGEPVEWAKPYGVVEREGKKVGFIGLATPETAYKT
KPDNVSHLEFKDPVEATKIWVDYLENEENVDAVVVLSHLGSEQNRETGEITGEIVEVAEV
PGVDAIISAHSHQKVEGKVNGVPVIQAYKNGRNLGYVNLKFDYKDELVVTTKLDDISKRK
DTLPVDKNMKDILANFEADLAPIMNEKVADLSVDLPHDRDTGVSPMGATVTETMRRIVDA
DIAITNGGGVRAPLMAGTVTVGDMYTILPFDNTLITMEMKGSDIIKVLEHGIEPDNFGWG
QHAGVKLWYTPGAERGEKITSVRLADGTKLENDKYYKVVTNDFMAVGGDSYDFSAAKNVV
DTNLVIRDEMANYWKENGIDPITDLATLLEAGEDTTVDLEKPENPGNPETPENPDNGENL
PNTGMPFGTGAVAAMGTVLTIGGLAVLRKKKNNAA
Download sequence
Identical sequences Q0SRN0
289380.CPR_1917 gi|110803262|ref|YP_699227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]